PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN07541.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 333aa    MW: 38299.6 Da    PI: 4.602
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN07541.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.21.1e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W++ ++  g+ R++k+c++rw +yl
       KHN07541.1 14 KGPWTAEEDKKLINFILTNGQCCWRALPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.13.1e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++ E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
       KHN07541.1  71 SEYEEKMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.3E-20563IPR009057Homeodomain-like
PROSITE profilePS5129412.641961IPR017930Myb domain
SuperFamilySSF466891.61E-2611108IPR009057Homeodomain-like
SMARTSM007179.9E-121363IPR001005SANT/Myb domain
PfamPF002491.8E-131461IPR001005SANT/Myb domain
CDDcd001678.52E-81661No hitNo description
PROSITE profilePS5129425.60962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2464117IPR009057Homeodomain-like
SMARTSM007173.8E-1466114IPR001005SANT/Myb domain
PfamPF002495.0E-1471111IPR001005SANT/Myb domain
CDDcd001674.57E-1074112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLINFIL TNGQCCWRAL PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEYEEKMVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPVTHKPLS NKTEETQAQP DEQTHQPLQE QQQQQQQHQH QQQPIPVEKD LKFEPEKEQN  180
REPETSVESS TITEEVKEED QIMTPLFDSW ELMNEFCTDE APIIEPNEIL VPSAPSSTSP  240
TTTTISSSTS TSSYSNSSNF LEDLLLPDLE WSDDYNDTNF DNNSSMALWD DDFIGSWNSL  300
INGDGDRKQV FDAPINQYPR VIMDSDSWDY GLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5550560.0FJ555056.1 Glycine max transcription factor MYB947 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553077.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-86ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0B2PDR30.0A0A0B2PDR3_GLYSO; Protein ODORANT1
STRINGGLYMA18G04580.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.16e-91myb domain protein 43
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]